CD137L-muCD8 Purified (Preservative-free)
Human CD137L (4-1BB Ligand) is a type II transmembrane protein constitutively expressed by monocytes, B cells and neuroblastoma cells (1). Binding of CD137 (4-1BB) to CD137L induces monocyte activation (2).
Molecular Structure: A soluble molecule consisting of the extracellular domain of murine CD8 alpha(167aa): kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvnstttkpvlrtpspvhptgtsqpqrpedcrprgsvkgtgldfacd
Linking amino acids: gt
Fused to the extracellular domain of human CD137L (184aa): regpelspddpaglldlrqgmfaqlvaqnvllidgplswysdpglagvsltgglsykedtkelvvakagvyyvffqlelrrvvagegsgsvslalhlqplrsaagaaalaltvdlppassearnsafgfqgrllhlsagqrlgvhlhteararhawqltqgatvlglfrvtpeipaglpsprse
Predicted non glycosylated monomeric molecular weight: 38.2 kd.
Transfectant Cell Line: CHO
Functional Application: Human CD137L-muCD8 binds to CD137 in FACS (3) and EIA(4). It blocks binding of anti-CD137 monoclonal antibody (clone 4B4-1) to CD137 expressing cells in FACS. Immobilzed CD137L can induce cytokine expression (IL-4, IL-10, IL-13) by CD137 expressing T cells (5).
References:
1. M.R. Alderson, et al, (1994) Eur J Immunol 24: 2219-2227.
2. J. Langstein, et al, (1998) J Immunol 160: 2488-2494.
3. W.Lin, S.E. Strome, et al. (2008) Blood 112: 699-707. PMID 18519814
4. M Cho, J Myoung (Dec 2015) J General Virology 96(12): 3635-3645. PMID 26467721