CD137L-muCD8 Biotinylated

Human CD137L (4-1BB Ligand) is a type II transmembrane protein constitutively expressed by monocytes, B cells and neuroblastoma cells (1).  Binding of CD137 (4-1BB) to CD137L induces monocyte activation (2).

Molecular Structure: A soluble molecule consisting of the extracellular domain of murine CD8 alpha(167aa): kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvnstttkpvlrtpspvhptgtsqpqrpedcrprgsvkgtgldfacd

Linking amino acids:   gt

Fused to the extracellular domain of human CD137L (184aa):  regpelspddpaglldlrqgmfaqlvaqnvllidgplswysdpglagvsltgglsykedtkelvvakagvyyvffqlelrrvvagegsgsvslalhlqplrsaagaaalaltvdlppassearnsafgfqgrllhlsagqrlgvhlhteararhawqltqgatvlglfrvtpeipaglpsprse

Predicted non glycosylated monomeric molecular weight:  38.2 kd.

Transfectant Cell Line: CHO

Functional Application: Human CD137L-muCD8 binds to CD137 in FACS (3) and EIA(4).  It  blocks binding of anti-CD137 monoclonal antibody (clone 4B4-1)  to CD137 expressing cells in FACS. Immobilzed CD137L can induce cytokine expression (IL-4, IL-10, IL-13) by CD137 expressing T cells (5).

References:

1.   M.R. Alderson, et al, (1994) Eur J Immunol  24: 2219-2227.

2.   J. Langstein, et al, (1998) J Immunol  160: 2488-2494.

3.  W.Lin,  S.E. Strome, et al. (2008) Blood 112: 699-707.  PMID 18519814

4.  M Cho, J Myoung (Dec 2015) J General Virology 96(12): 3635-3645. PMID 26467721

5.  Alfaro C, Melero I, et al. (2015) OncoImmunology 4(12): e1054597.  doi: 10.1080/2162402X.2015.1054597.

USD $400.00
In cart: 0
= $400.00
Catalog #:
503-030
Form:
Biotin
Size:
25 µg
Alternate Name:
4-1BBL
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads