TIGIT-muIg Purified (Preservative-free)
INFORMATION: Human TIGIT (T cell immunoreceptor with Ig and ITIM domains) is a coinhibitory receptor expressed by activated T cells, memory T cells, Treg cells and NK cells. It binds to CD155(PVR) and less avidly to CD112(PVRL2). Blockade of the TIGIT/CD155 axis shows promise in restoring T cell function in pancreatic cancer(2).
Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human TIGIT fused to murine IgG2a Fc.
Residual signal peptide amino acids (7aa): kpqapel
Mature TIGIT(EC) (118aa): (22)mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgarfq(139)
Linking amino acids (2aa): fq
Murine IgG2aFc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk
Predicted nonglycosylated monomeric weight: 40 kd. TIGIT-muIg runs as a dimer in SDS-PAGE with a molecular weight of approximately 100 kD.
Transfectant Cell Line: CHO