TIGIT-muIg Biotinylated

INFORMATION:   Human TIGIT (T cell immunoreceptor with Ig and ITIM domains) is a coinhibitory receptor expressed by activated T cells, memory T cells, Treg cells and NK cells.  It binds to CD155(PVR) and less avidly to CD112(PVRL2). Blockade of the TIGIT/CD155 axis shows promise in restoring T cell function in pancreatic cancer(2).

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human TIGIT fused  to murine IgG2a Fc.

Residual  signal peptide amino acids (7aa): kpqapel

Mature TIGIT(EC) (118aa): (22)mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgarfq(139)

Linking amino acids (2aa):  fq

Murine IgG2aFc (233aa):  eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 40 kd.  TIGIT-muIg  runs as a dimer in  SDS-PAGE with a molecular weight of approximately 100 kD.

Transfectant Cell Line:  CHO                           

References: 1)  Dougall WC, AC Anderson, et al. (2017) Immunol Rev 276(1): 112-120. doi: 10.1111/imr.12518.  PMID: 28258695.

2) Freed-Pastor WA, Tyler Jacks, et al. (July 2021) Cancer Cell S1535-6108(21)00384-6. doi: 10.1016/j.ccell.2021.07.007

USD $400.00
In cart: 0
= $400.00
Catalog #:
25 µg
Alternate Name:
WUCAM, Vstm3

Application Key

Flow Cytometry
Western blot
Enzyme Immunoassay
Fixed paraffin section
Paraffin section
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

