TIGIT-muIg Purified (with Antibiotics)

INFORMATION:   Human TIGIT (T cell immunoreceptor with Ig and ITIM domains) is a coinhibitory receptor expressed by activated T cells, memory T cells, Treg cells and NK cells.  It binds to CD155(PVR) and less avidly to CD112(PVRL2). Blockade of the TIGIT/CD155 axis shows promise in restoring T cell function in pancreatic cancer(2).

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human TIGIT fused  to murine IgG2a Fc.

Residual  signal peptide amino acids (7aa): kpqapel

Mature TIGIT(EC) (118aa): (22)mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgarfq(139)

Linking amino acids (2aa):  fq

Murine IgG2aFc (233aa):  eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 40 kd.  TIGIT-muIg  runs as a dimer in  SDS-PAGE with a molecular weight of approximately 100 kD.

Transfectant Cell Line:  CHO                           

References: 1)  Dougall WC, AC Anderson, et al. (2017) Immunol Rev 276(1): 112-120. doi: 10.1111/imr.12518.  PMID: 28258695.

2) Freed-Pastor WA, Tyler Jacks, et al. (July 2021) Cancer Cell S1535-6108(21)00384-6. doi: 10.1016/j.ccell.2021.07.007

USD $325.00
In cart: 0
= $325.00
Catalog #:
556-020
Form:
Pur/WA
Size:
25 µg
Alternate Name:
WUCAM, Vstm3
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads