CD152(CTLA-4)-muIg Biotinylated

Human CD152 (CTLA-4) is a cell surface glycoprotein expressed at low levels on activated T cells (1).  CD152  is a high affinity receptor for the costimulatory molecules CD80 (B7-1) and CD86 (B7-2) and appears to function as a negative regulator of T cell activation (2, 3).  A soluble fusion protein combining the extracellular (125aa) domain of human CD152 and murine IgG2a Fc (CTLA-4 Ig) was developed (4).

Molecular Structure: A soluble 110 kd dimeric fusion protein consisting of the extracellular (125aa) domain of human CTLA-4 fused to murine IgG2a Fc (233aa), with a predicted non glycosylated monomeric molecular weight of 40.1 kd.

Sequence:

CD152 mature EC: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf

+linker:   gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

 Transfectant Cell Line: BHK

Functional Application: CD152 Ig binds with high affinity to human or mouse CD80 (B7-1) and CD86 (B7-2) (4, 5).  CD152-muIg blocks the binding of anti-human CD80 (B7-1) and anti-humanCD86 (B7-2) mAbs to recepters on Raji cells.  It cross reacts with CD80 and CD86 accross a broad range of mammalian species including pig (6, 7).

References:

1.  T. Lindsten, et al, (1993) J Immunol  151: 3489-3499.

2.  T.L. Walunas, et al, (1994) Immunity  1: 405-413.

3.  N.J. Karandikar, et al, (1996) J Exp Med  184: 783-788.

4.  A.H. Cross, et al, (1995) J Clin Invest  95: 2783-2789.

5.  P.A. Morton, et al, (1996) J Immunol  156: 1047-1054.

6). Takamatsu H, RME Parkhouse, et al. (1999) Immunology 97(2):211-213.

7).  Le Leduec JB, B Dubois, et al. (2016) Vaccine 34(7): 914-22.  PMID: 26768129