CD152(CTLA-4)-muIg R-PE Conjugate

Human CD152 (CTLA-4) is a cell surface glycoprotein expressed at low levels on activated T cells (1).  CD152  is a high affinity receptor for the costimulatory molecules CD80 (B7-1) and CD86 (B7-2) and appears to function as a negative regulator of T cell activation (2, 3).  A soluble fusion protein combining the extracellular (125aa) domain of human CD152 and murine IgG2a Fc (CTLA-4 Ig) was developed (4).

Molecular Structure: A soluble 110 kd dimeric fusion protein consisting of the extracellular (125aa) domain of human CTLA-4 fused to murine IgG2a Fc (233aa), with a predicted non glycosylated monomeric molecular weight of 40.1 kd.

Sequence:

CD152 mature EC: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf

+linker:   gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

 Transfectant Cell Line: BHK

Functional Application: CD152 Ig binds with high affinity to human or mouse CD80 (B7-1) and CD86 (B7-2) (4, 5).  CD152-muIg blocks the binding of anti-human CD80 (B7-1) and anti-humanCD86 (B7-2) mAbs to recepters on Raji cells.  It cross reacts with CD80 and CD86 accross a broad range of mammalian species including pig (6, 7).

References:

1.  T. Lindsten, et al, (1993) J Immunol  151: 3489-3499.

2.  T.L. Walunas, et al, (1994) Immunity  1: 405-413.

3.  N.J. Karandikar, et al, (1996) J Exp Med  184: 783-788.

4.  A.H. Cross, et al, (1995) J Clin Invest  95: 2783-2789.

5.  P.A. Morton, et al, (1996) J Immunol  156: 1047-1054.

6). Takamatsu H, RME Parkhouse, et al. (1999) Immunology 97(2):211-213.

7).  Le Leduec JB, B Dubois, et al. (2016) Vaccine 34(7): 914-22.  PMID: 26768129

USD $575.00
In cart: 0
= $575.00
Catalog #:
501-050
Form:
R-PE
Size:
50 tests
Alternate Name:
CTLA-4
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads