muIgFc Control Protein Purified (Preservative-free)

Recombinant muIg control protein was engineered to be a negative control for muIg containing fusion proteins.

Molecular Structure: A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13)

fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246)

Predicted non glycosylated monomeric molecular weight: 27.8 kd.  In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.

Transfectant Cell Line:   CHO

USD $325.00
In cart: 0
= $325.00
Catalog #:
581-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
Mouse IgG2a hinge + Fc
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads