muIgFc Control Protein Biotinylated

Recombinant muIg control protein was engineered to be a negative control for muIg containing fusion proteins.

Molecular Structure: A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13)

fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246)

Predicted non glycosylated monomeric molecular weight: 27.8 kd.  In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.

Transfectant Cell Line:   CHO

USD $325.00
In cart: 0
= $325.00
Catalog #:
25 µg
Alternate Name:
Mouse IgG2a hinge + Fc

Application Key

Flow Cytometry
Western blot
Enzyme Immunoassay
Fixed paraffin section
Paraffin section
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

