muIgFc Control Protein Biotinylated
Recombinant muIg control protein was engineered to be a negative control for muIg containing fusion proteins.
Molecular Structure: A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13)
fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246)
Predicted non glycosylated monomeric molecular weight: 27.8 kd. In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.
Transfectant Cell Line: CHO