CD275-muIg Purified (with Antibiotics)
Molecular Structure: A soluble dimeric fusion protein consisting of a portion of the extracellular domain of human CD275 (GL50, ICOSL, B7-H2, B7RP-1) (213aa): dtqekevramvgsdvelscacpegsrfdlndvyvywqtsesktvvtyhipqnsslenvdsryrnralmspagmlrgdfslrlfnvtpqdeqkfhclvlsqslgfqevlsvevtlhvaanfsvpvvsaphspsqdeltftctsingyprpnvywinktdnslldqalqndtvflnmrglydvvsvlriartpsvnigccienvllqqnltvgsq with linking amino acids: gt
fused to murine IgG2a Fc (232 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk
predicted nonglycosylated monomeric molecular weight: 50.4 kd.
Transfectant Cell Line: CHO
Functional Application: CD275-muIg binds with high affinity to cell surface CD278 (ICOS) expressed on CD8 positive human T cells. It’s binding is blocked by pre incubation with recombinant 278-muIg (cat.no. 517-020)
References:
1 Beier, K.C., R.A. Kroczek, et al. 2000, Eur J Immunol . 30(12):3707-3717.
2 Riley, J.L., C.H. June, et al. 2001, J. Immunol. 166: 4943-4948.
3 Ling, V., M. Collins, et al. 2000, J. Immunol. 164: 1653-1657.
4 Ling, V., M. Collins, et al. 2001, J. Immunol. 166: 7300-7308.