CD273(PD-L2)-muIg Biotinylated

A soluble fusion protein consisting of the

Mature extracellular region of  CD273EC: (20)lftvtvpkelyiiehgsnvtlecnfdtgshvnlgaitaslqkvendtsphreratlleeqlplgkasfhipqvqvrdegqyqciiiygvawdykyltlkvkasyrkinthilkvpetdeveltcqatgyplaevswpnvsvpantshsrtpeglyqvtsvlrlkpppgrnfscvfwnthvreltlasidlqsqmeprthpt(220)

Linker +Murine IgG2a Hinge + Fc : (221)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtvtcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklgvekknwvernsyscsvvheglhnhhttksfsrtpg(455)

Predicted monomeric (non glycosylated) molecular weight: 49 kd. The molecule is dimeric and runs at ~135 kd in SDS-PAGE under native conditions, and ~74 kd reduced

Transfectant Cell Line: CHO

INFORMATION: CD273 (B7-DC, PCDL-2, Programmed cell death ligand 2, Butyrophilin-like protein) is a type I surface molecule with homology to CD80, CD86, CD274.  It is expressed primarily by Dendritic cells.and provides a stimulatory signal to CD279 (PD-1, Programmed Death molecule) which serves an important immunoregulatory role by down regulating T cell response.  CD273 binds to CD279(PD-1) with a 2- 6 fold higher affinity than CD274(2).

Recombinant CD273-muIg binds to recombinant CD279 in EIA.

References:

1) E N Rozali, W J Lesterhuis, et al. (2012) Clin Develop Immunol 2012: 656340. 

2) P Youngnak, H Konozo, et al. (2003) Biochemical and Biophysical Research Communications 307(3): 672-677.

USD $400.00
In cart: 0
= $400.00
Catalog #:
573-030
Form:
Biotin
Size:
25 µg
Alternate Name:
B7-DC, PD-L2, Programmed Death Ligand 2, Butyrophilin-like protein
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads