CD273(PD-L2)-muIg Purified (with Antibiotics)
A soluble fusion protein consisting of the
Mature extracellular region of CD273EC: (20)lftvtvpkelyiiehgsnvtlecnfdtgshvnlgaitaslqkvendtsphreratlleeqlplgkasfhipqvqvrdegqyqciiiygvawdykyltlkvkasyrkinthilkvpetdeveltcqatgyplaevswpnvsvpantshsrtpeglyqvtsvlrlkpppgrnfscvfwnthvreltlasidlqsqmeprthpt(220)
Linker +Murine IgG2a Hinge + Fc : (221)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtvtcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklgvekknwvernsyscsvvheglhnhhttksfsrtpg(455)
Predicted monomeric (non glycosylated) molecular weight: 49 kd. The molecule is dimeric and runs at ~135 kd in SDS-PAGE under native conditions, and ~74 kd reduced
Transfectant Cell Line: CHO
INFORMATION: CD273 (B7-DC, PCDL-2, Programmed cell death ligand 2, Butyrophilin-like protein) is a type I surface molecule with homology to CD80, CD86, CD274. It is expressed primarily by Dendritic cells.and provides a stimulatory signal to CD279 (PD-1, Programmed Death molecule) which serves an important immunoregulatory role by down regulating T cell response. CD273 binds to CD279(PD-1) with a 2- 6 fold higher affinity than CD274(2).
Recombinant CD273-muIg binds to recombinant CD279 in EIA.
References:
1) E N Rozali, W J Lesterhuis, et al. (2012) Clin Develop Immunol 2012: 656340.