CD304-muIg Purified (Preservative-free)

INFORMATION:  Human CD304 (neuropilin, NRP, NP1, BDCA-4) is a 140 kD type I glycoprotein expressed by a variety of tissue types,including Treg, follicular TH, neurons, Dendritic cells, and Endothelial cells. Its ligands include VEGF165 and Semaphorin family members. It is a reliable marker for human BCP-ALL1. Soluble CD304 has been used to slow progression of murine AML 2.     CD304-muIg runs as a dimer in SDS-PAGE with a molecular weight of approximately 200 kD.

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human CD304 fused to murine IgG2a Fc.

Residual signal peptide amino acids (6aa): kpqape

Mature CD304(EC) (623aa): (22)frndkcgdtikiespgyltspgyphsyhpsekcewliqapdpyqriminfnphfdledrdckydyvevfdgenenghfrgkfcgkiapppvvssgpflfikfvsdyethgagfsiryeifkrgpecsqnyttpsgvikspgfpekypnslectyivfvpkmseiilefesfdlepdsnppggmfcrydrleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanysvlqssvsedfkcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgllrfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvvavfpkplitrfvrikpatwetgismrfevygckitdypcsgmlgmvsglisdsqitssnqgdrnwmpenirlvtsrsgwalppaphsyinewlqidlgeekivrgiiiqggkhrenkvfmrkfkigysnngsdwkmimddskrkaksfegnnnydtpelrtfpalstrfiriyperathgglglrmellgceveaptagpttpngnlvdecdddqanchsgtgddfqltggttvlatekptvidstiqsefp(644)

Murine IgG2aFc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 97 kd.

Functional Application: Recombinant CD304-muIg binds to immobilized VEGF165 in EIA.

Transfectant Cell Line:  HEK

References:

1) Pratyusha Gudapati Prashant R Tembhare , et al. (2020 Jul) Cytometry B Clin Cytom. 98(4):328-335. doi: 10.1002/cyto.b.21866. Epub 2020 Jan 16.

2) Gagnon ML, Klagsbrun M, et al. (March 2000). ” Proceedings of the National Academy of Sciences of the United States of America. 97 (6): 2573–8. Bibcode:2000PNAS…97.2573G. doi:10.1073/pnas.040337597. PMC 15970. PMID 10688880.

USD $325.00
In cart: 0
= $325.00
Catalog #:
557-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
neuropilin, NRP, NP1, BDCA-4
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads

Other Forms