CD123(IL-3Rα)-muIg Purified (Preservative-free)

INFORMATION:  Human CD123 (Interleukin 3 Receptor alpha) is a 70kD type I transmembrane molecule, and is the low affinity receptor for the cytokine IL-3, which can stimulate proliferation or differentiation.  When paired in a heterodimer with CD131 (IL-3 R beta), it binds IL-3 with much higher affinity.  CD123 is found on Myeloid precusors, Stem cells, a subset of T cells, some B cells Megakaryocytes, basophils, monocytes and epithelial cells.  CD123 is present at high levels on many hematologic malignancies and antibodies(2) and CAR T cells(1). Antibodies against CD123 have been used successfully to combat Acute Myeloid Leukemia (2).

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human CD123 fused  to murine IgG2a Fc.

Mature CD123(EC) (307 aa): tkedpnppitnlrmkakaqqltwdlnrnvtdiecvkdadysmpavnnsycqfgaislcevtnytvrvanppfstwilfpensgkpwagaenltcwihdvdflscswavgpgapadvqydlylnvanrrqqyeclhyktdaqgtrigcrfddisrlssgsqsshilvrgrsaafgipctdkfvvfsqieiltppnmtakcnkthsfmhwkmrshfnrkfryelqiqkrmqpviteqvrdrtsfqllnpgtytvqirarervyeflsawstpqrfecdqeegantrawrtsllialgtllalvcvfvic

Linking amino acids (2aa):  gt

Murine IgG2aFc (233aa):  eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 61.6 kd. 

Transfectant Cell Line:  CHO

References:

1)  Pizzitola I, Bonnet D, et al. (2014) Leukemia 28(8): 1596-1605. doi: 10.1038/leu.2014.62 

2)  Jin L, Lock RB, et al. (2009) Cell Stem Cell 5(1): 31-42.  doi: 10.1016/j.stem.2009.04.018. 

USD $325.00
In cart: 0
= $325.00
Catalog #:
545-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
IL-3R alpha, Interleukan 3 Receptor alpha, MGC34174
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads