CD123(IL-3Rα)-muIg Purified (with Antibiotics)

INFORMATION:  Human CD123 (Interleukin 3 Receptor alpha) is a 70kD type I transmembrane molecule, and is the low affinity receptor for the cytokine IL-3, which can stimulate proliferation or differentiation.  When paired in a heterodimer with CD131 (IL-3 R beta), it binds IL-3 with much higher affinity.  CD123 is found on Myeloid precusors, Stem cells, a subset of T cells, some B cells Megakaryocytes, basophils, monocytes and epithelial cells.  CD123 is present at high levels on many hematologic malignancies and antibodies(2) and CAR T cells(1). Antibodies against CD123 have been used successfully to combat Acute Myeloid Leukemia (2).

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human CD123 fused  to murine IgG2a Fc.

Mature CD123(EC) (307 aa): tkedpnppitnlrmkakaqqltwdlnrnvtdiecvkdadysmpavnnsycqfgaislcevtnytvrvanppfstwilfpensgkpwagaenltcwihdvdflscswavgpgapadvqydlylnvanrrqqyeclhyktdaqgtrigcrfddisrlssgsqsshilvrgrsaafgipctdkfvvfsqieiltppnmtakcnkthsfmhwkmrshfnrkfryelqiqkrmqpviteqvrdrtsfqllnpgtytvqirarervyeflsawstpqrfecdqeegantrawrtsllialgtllalvcvfvic

Linking amino acids (2aa):  gt

Murine IgG2aFc (233aa):  eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 61.6 kd. 

Transfectant Cell Line:  CHO


1)  Pizzitola I, Bonnet D, et al. (2014) Leukemia 28(8): 1596-1605. doi: 10.1038/leu.2014.62 

2)  Jin L, Lock RB, et al. (2009) Cell Stem Cell 5(1): 31-42.  doi: 10.1016/j.stem.2009.04.018. 

USD $325.00
In cart: 0
= $325.00
Catalog #:
25 µg
Alternate Name:
IL-3R alpha, Interleukan 3 Receptor alpha, MGC34174

Application Key

Flow Cytometry
Western blot
Enzyme Immunoassay
Fixed paraffin section
Paraffin section
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

