CD244(2B4)-muIg Purified (with Antibiotics)

CD244 (2B4, SLAMF4) is a 66 kD member of the CD2/SLAM related receptor family (SRR).  It is expressed on NK (3), Tcell subsets, monocytes and eosinophils(4).  It is expressed at high levels on Leuikemia initiating cells, and plays a role in their proliferative potential (5). In mice there are two transcription variants, a long form and a short form of CD244 each of which have distinct signaling properties.  In humans, only the long form is expressed.   

Decreased CD244 expression on monocytes of SLE patients correlated (negatively) with autoantibody titer(2).  CD244 mediated function in immune response can vary greatly dependant on the context of its ligation.

Molecular Structure: A soluble molecule consisting of  murine CD8 alpha signal peptide residual amino acids and linker: (1)kpqapegkgc(10)

the mature extracellular domain of human CD244 (199aa): (11)qgsadhvvsisgvplqlqpnsiqtkvdsiawkkllpsqngfhhilkwengslpsntsndrfsfivknlsllikaaqqqdsglyclevtsisgkvqtatfqvfvfdkvekprlqgqgkildrgrcqvalsclvsrdgnvsyawyrgskliqtagnltyldeevdingthtytcnvsnpvsweshtlnltqdcqnahqefr(209) murine IgG2a Fc + hinge regions: (233aa) eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk (442aa total).

The molecule has a predicted monomeric non glycosylated molecular weight of 49.5 kd..  The molecule is dimeric. In SDS-PAGE, it runs at apporoximately 135 kD native, and  70 kD reduced.. CD244-muIg binds to recombinant CD48 in EIA and cell surface CD48 on Raji cell surface in FACS.  This binding is blocked by anti-CD48 mAb (Cat#199-020).

Transfectant Cell Line:            CHO

References:   

1)  Boles KS, Mathew PA, et al. (1999) Tissue Antigens 54(1): 27-34.

2)  Mak A, AM Fairhurst, et al. (2017) Clinical Rheumatology 37(3): 811-816. doi.org/10.1007/s10067-017-3698-2.

3)  Vacca P, MC Mingarri, et al. (2006) Blood 108: 4078-4085.

4)  Munitz A, Levi-Schaffer F, et al. (2005) J Immunol 174(1): 110-118.

5)  Zhang F, Zheng J, et al. (2017) Haematologica  Doi: 10.3324/haematol.2016.151555.