CD278(ICOS)-muIg Purified (with Antibiotics)

The inducible costimulator CD278 (ICOS, T cell activation molecule H4) is similar to human CD28 (24% homology), and plays an analogous role in the T cell activation process.  Each secondary signal from CD28 or ICOS results in a discrete cytokine secretion profile displayed by the activated T cell.1  Both activation processes are effectively down regulated by CD152 (CTLA-4) engagement.2  Human CD275 (ICOSL, GL50, B7-H2) is a member of the B7 family sharing ~20% homology with CD80 (B7-1) and CD86 (B7-2), and has been shown to be a ligand for CD278.3 CD278-muIg recombinant protein binds to recombinant CD275-muIg in EIA.

Molecular Structure:   A soluble  fusion protein consisting of the extracellular (121aa) domain of mature human CD278(ICOS): eingsanyemfifhnggvqilckypdivqqfkmqllkggqilcdltktkgsgntvsikslkfchsqlsnnsvsfflynldhshanyyfcnlsifdpppfkvtltggylhiyesqlccqlkf

linker amino acids: gt

fused to murine IgG2a Fc (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

predicted nonglycosylated monomeric molecular weight: 40.4 kd.

Transfectant Cell Line:  CHO

Functional Application:   CD278-muIg binds  to recombinant CD275(ICOSL, GL50)-muIg in EIA.

References: 

1Beier, K.C., R.A. Kroczek, et al. 2000, Eur J Immunol. 30(12):3707-3717.

2 Riley, J.L., C.H. June, et al. 2001, J. Immunol. 166: 4943-4948.

3 Ling, V., M. Collins, et al. 2000, J. Immunol. 164: 1653-1657.

4 Ling, V., M. Collins, et al. 2001, J. Immunol. 166: 7300-7308.

5 A.J. McAdam, et al, (2000) J Immunol 165: 5035-5040.

USD $325.00
In cart: 0
= $325.00
Catalog #:
517-020
Form:
Pur/WA
Size:
25 µg
Alternate Name:
ICOS, AILIM, ICOS-Fc, ICOS-muIg, ICOS-Ig
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads