CD54-muIg Purified (Preservative-free)

Human CD54 (ICAM-1) mediates cell adhesion by binding to the integrins CD11a/CD18 (LFA-1) and to CD11b/CD18 (Mac-1).  CD54 expression on resting peripheral blood leukocytes is weak but is upregulated on activated T and B lymphocytes and on monocytes.

Molecular Structure: A soluble dimeric fusion protein consisting of the extracellular (451aa) domain of human CD54 (including  signal peptide) fused to murine IgG2a Fc + hinge (232aa). Predicted monomeric molecular weight of mature construct 76.1kd (amino acid composition only).

CD54(EC): qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqedsqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsakasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsfscsatlevagqlihknqtrelrvlygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdlegtylcrarstqgevtrevtvnvlsprye

Linker: gt

muIg FC + hinge: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Transfectant Cell Line: CHO

References:

1) A.R. Berendt, et al, (1992) Cell  68: 71-81. 

2) I. Dransfield, et al, (1992) J Cell Biol  116: 1527-1535. 

3) Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1548-1550.

4) P.L. Reilly, et al, (1995) J Immunol  155: 529-532

USD $325.00
In cart: 0
= $325.00
Catalog #:
514-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
ICAM-1
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads