CD54-muIg Purified (with Antibiotics)

Human CD54 (ICAM-1) mediates cell adhesion by binding to the integrins CD11a/CD18 (LFA-1) and to CD11b/CD18 (Mac-1).  CD54 expression on resting peripheral blood leukocytes is weak but is upregulated on activated T and B lymphocytes and on monocytes.

Molecular Structure: A soluble dimeric fusion protein consisting of the extracellular (451aa) domain of human CD54 (including  signal peptide) fused to murine IgG2a Fc + hinge (232aa). Predicted monomeric molecular weight of mature construct 76.1kd (amino acid composition only).

CD54(EC): qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqedsqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsakasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsfscsatlevagqlihknqtrelrvlygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdlegtylcrarstqgevtrevtvnvlsprye

Linker: gt

muIg FC + hinge: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Transfectant Cell Line: CHO


1) A.R. Berendt, et al, (1992) Cell  68: 71-81. 

2) I. Dransfield, et al, (1992) J Cell Biol  116: 1527-1535. 

3) Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1548-1550.

4) P.L. Reilly, et al, (1995) J Immunol  155: 529-532

USD $325.00
In cart: 0
= $325.00
Catalog #:
25 µg
Alternate Name:

Application Key

Flow Cytometry
Western blot
Enzyme Immunoassay
Fixed paraffin section
Paraffin section
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

