CD80-muIg Biotinylated

Human CD80 (B7-1) is a costimulatory ligand for CD28 and CTLA-4(1).   CD80 is expressed on activated B cells (2).

Molecular Structure:  A soluble dimeric fusion protein consisting of the extracellular (216aa) domain of  human CD80 fused to murine IgG2a Fc + hinge. :

CD80 EC (216 aa):


+linker (2 aa): gt

Murine IgG2a Fc (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight: 51.3 kd.

Transfectant Cell Line:  CHO

Functional Application:   CD80-muIg fusion protein binds to native and recombinant CD152.


1.  C.B. Thompson, (1995) Cell  81: 979-982. 

2.   Leukocyte Typing V (S.F. Schlossman, et al, eds.)  Oxford University Press, Oxford, (1995) p. 682-684.

USD $400.00
In cart: 0
= $400.00
Catalog #:
25 µg
Alternate Name:

Application Key

Flow Cytometry
Western blot
Enzyme Immunoassay
Fixed paraffin section
Paraffin section
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

