CD80-muIg Purified (with Antibiotics)

Human CD80 (B7-1) is a costimulatory ligand for CD28 and CTLA-4(1).   CD80 is expressed on activated B cells (2).

Molecular Structure:  A soluble dimeric fusion protein consisting of the extracellular (216aa) domain of  human CD80 fused to murine IgG2a Fc + hinge. :

CD80 EC (216 aa):

glshfcsgvihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifditnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvkadfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelyavsskldfnmttnhsfmclikyghlrvnqtfnwnttkqehfpdn

+linker (2 aa): gt

Murine IgG2a Fc (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight: 51.3 kd.

Transfectant Cell Line:  CHO

Functional Application:   CD80-muIg fusion protein binds to native and recombinant CD152.

References: 

1.  C.B. Thompson, (1995) Cell  81: 979-982. 

2.   Leukocyte Typing V (S.F. Schlossman, et al, eds.)  Oxford University Press, Oxford, (1995) p. 682-684.

USD $325.00
In cart: 0
= $325.00
Catalog #:
510-020
Form:
Pur/WA
Size:
25 µg
Alternate Name:
B7-1
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads