CD80-muIg Purified (with Antibiotics)
Human CD80 (B7-1) is a costimulatory ligand for CD28 and CTLA-4(1). CD80 is expressed on activated B cells (2).
Molecular Structure: A soluble dimeric fusion protein consisting of the extracellular (216aa) domain of human CD80 fused to murine IgG2a Fc + hinge. :
CD80 EC (216 aa):
glshfcsgvihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifditnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvkadfptpsisdfeiptsnirriicstsggfpephlswlengeelnainttvsqdpetelyavsskldfnmttnhsfmclikyghlrvnqtfnwnttkqehfpdn
+linker (2 aa): gt
Murine IgG2a Fc (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg
Predicted monomeric molecular weight: 51.3 kd.
Transfectant Cell Line: CHO
Functional Application: CD80-muIg fusion protein binds to native and recombinant CD152.
References:
1. C.B. Thompson, (1995) Cell 81: 979-982.
2. Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 682-684.