CD40-muIg Biotinylated

Human CD40 is a member of the tumor necrosis factor (TNF) receptor family and is present on all B cells except plasma cells.  CD40 is also found on some epithelial cells, carcinomas and lymphoid dendritic cells.  CD40 plays an important role in B cell activation and the interaction with its ligand CD154 (CD40 Ligand) is essential for isotype switching (1).

Molecular Structure:  A soluble fusion protein consisting of the mature extracellular (173aa) domain of human CD40: epptacrekqylinsqccslcqpgqklvsdctefteteclpcgesefldtwnrethchqhkycdpnlglrvqqkgtsetdtictceegwhctseacescvlhrscspgfgvkqiatgvsdticepcpvgffsnvssafekchpwtscetkdlvvqqagtnktdvvcgpqdrlr

+linker: gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight of 45.6 kd. The dimeric protein runs at ~95 kD in SDS-PAGE.

Transfectant Cell Line: CHO

Functional Application: CD40-muIg fusion protein blocks binding of anti-human CD40 to Raji human tumor cells.

References:

1.  T.A. Foy, et al, (1996) Annu Rev Immunol  14: 591-617.

2.  M.E. Ozaki, et al, (1997) J Immunol  159: 214-221

3.  N. Hubbard,  T. R. Torgerson, et al. (2016) Blood :blood-2015-11-683235; doi: https://doi.org/10.1182/blood-2015-11-683235

USD $400.00
In cart: 0
= $400.00
Catalog #:
504-030
Form:
Biotin
Size:
25 µg
Alternate Name:
TNFRSF5
Applications:
EIA, FC(3)

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads