CD40-muIg Purified (with Antibiotics)
Molecular Structure: A soluble fusion protein consisting of the mature extracellular (173aa) domain of human CD40: epptacrekqylinsqccslcqpgqklvsdctefteteclpcgesefldtwnrethchqhkycdpnlglrvqqkgtsetdtictceegwhctseacescvlhrscspgfgvkqiatgvsdticepcpvgffsnvssafekchpwtscetkdlvvqqagtnktdvvcgpqdrlr
+linker: gt
fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg
Predicted monomeric molecular weight of 45.6 kd. The dimeric protein runs at ~95 kD in SDS-PAGE.
Transfectant Cell Line: CHO
Functional Application: CD40-muIg fusion protein blocks binding of anti-human CD40 to Raji human tumor cells. It has proven to be a useful tool in identifying CD154 mutations such as Hyper M syndrome(4).
References:
1. T.A. Foy, et al, (1996) Annu Rev Immunol 14: 591-617.
2. M.E. Ozaki, et al, (1997) J Immunol 159: 214-221
