CD86(var)-muIg Purified (with Antibiotics)

Human CD86 (B7-2) is a costimulating ligand for CD28 and CTLA-4.  CD86 is expressed on activated B cells and blood monocytes (3). 

Molecular Structure:  A soluble fusion protein consisting of the extracellular (224 aa) domain of  human CD86 fused to murine IgG2a Fc.  Compared to CD86 reference sequence Genebank #HUMB72A, the following polymorphisms are present:  H(113)R, M(120)V, M(126)I,  I(185)V.  This construct binds poorly to CD152.  Ancell now has three polymorphic variants of CD86-muIg available (see attachment).

CD86 EC  (224 aa):  (26)lkiqayfnetadlpcqfansqnqslselavfwqdqenlvlnevylgkekfdsvhskymgrtsfdsdswtlrlhnlqikdkglyqciirhkkptgiirihqinselsvlanfsqpeivpisnitenvyinltcssihgypepkkmsvllrtknstieydgvmqksqdnvtelydvsislsvsfpdvtsnmttfciletdktrllsspfsieledpqpppdhip(247)

+linker (2 aa):  gt

Murine IgG2a Fc +Hinge (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight: 52.2 kd.  The molecule is dimeric and runs at about 115 kd in SDS-PAGE under native conditions.

Transfectant Cell Line:  CHO

Functional Application:   CD86(var)-muIg fusion protein binds poorly to native and recombinant CD152, but is recognized well by anti-CD86 mAb (307-020).

References: 

1.  C. Caux, et al, (1994) J Exp Med  180: 1841-1847. 

2.   C.B. Thompson, (1995) Cell  81: 979-982. 

3.  Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 703-705. 

4.   D. Mauri, et al, (1995) J Immunol  155: 118-127.