CD155(PVR)-muIg Biotinylated

 Human CD155 (Polio Virus Receptor, PVR, Necl-5) is a 70 kd type I Ig superfamily molecule (1).1 It is involved in formation of intracellular junctions between epithelial cells.  Its ligands include CD226(DNAM-1), and CD96(TACTILE).  CD155 expression by tumor has been shown to be upregulated by Nitric Oxide(2).  High CD155 expression has recently been exploited to use engineered poliovirus to treat glioblastoma. (3)


Molecular Structure:           A soluble molecule consisting of the extracellular domain of  mature human CD155 fused  to murine IgG2a Fc.Mature CD155(EC) (316aa): dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsyseskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakpqntaevqkvqltgepvpmarcvstggrppaqitwhsdlggmpntsqvpgflsgtvtvtslwilvpssqvdgknvtckvehesfekpqlltvnltvyyppevsisgydnnwylgqneatltcdarsnpeptgynwsttmgplppfavaqgaqllirpvdkpinttlicnvtnalgarqaeltvqvkegppsehsgteha

Linking amino acids (2aa):  tr

Murine IgG2aFc (233aa):  eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 61kd.  .

Transfectant Cell Line:  CHO



1)  Medelsohn CL, Racaniello VR, et al. (1989) Cell 56(5): 855-65. 

2) C Fionda, M Cippitelli, et al. (2015) BMC Cancer 15(1):17  PMID 25609078.

3) Gromeier M, Bigner D, et al. (2014) Neuro-Oncology 16(supp3): iii41.

USD $400.00
In cart: 0
= $400.00
Catalog #:
25 µg
