CD272(BTLA)-muIg Purified (Preservative-free)

Human CD272 (BTLA, B and T Lymphocyte Attenuator) is a member of the Immunoglobulin superfamily and has homology to CD152(CTLA-4).  Engagement of BTLA by its co receptor CD270 (HVEM, a TNF superfamily member) can down regulate activated T and B cell responses.  BTLA levels on antigen specific CD8+ T cells have been reported to decrease in viral specific, but not melanoma specific activated lines (1). 

Recombinant CD272-muIg binds to recombinant HVEM-muIg in EIA. 

Ancell has a matched pair of antibodies (cat # 372-020 and 272-030) for capture and detection of CD272 protein in EIA (see attachment).

Molecular Structure:  A soluble fusion protein consisting of the muCD8 apha signal peptide residual amino acids+ linker: (1) kpqapelrgs(10)

CD272 mature EC: (11) ipyldiwnihgkescdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeeknisffilhfepvlpndngsyrcsanfqsnli eshsttlyvtdvksaserpskdemasrp(143)

Linker +Murine IgG2a Hinge + Fc : (144) gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgk efkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwverns yscsvvheglhnhhttksfsrtpg(378)

Predicted monomeric (non glycosylated) molecular weight: 43.0 kd. The molecule is dimeric and runs at ~100 kd in SDS-PAGE under native conditions, and ~50kd reduced.

Transfectant Cell Line:   CHO

References:

1) Derre’ L, DE Speiser, et al. (2010) J Clin Invest 120(1):157-167. 

2) Pasero C,D Olive, et al. (2009) Curr Mol Med 9 (7): 911-927.

3) Gavrieli M, KM Murphy, et al. (2006) Adv Immunol 92: 152-185.

USD $325.00
In cart: 0
= $325.00
Catalog #:
542-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
BTLA, B and T Lymphocyte Attenuator
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads