CD274 (PD-L1)-muIg Purified (Preservative-free)

CD274 (B7-H1, PD-L1, Programmed Death Ligand) is a member of the B7 family and is expressed on a variety of tissues including lymphoid cells.  It plays an important role in regulation of T cell activation, and is involved in progression of cancer, arthritis and HIV infection (3).  CD274 binding to its receptor CD279 (PD-1) on activated T cells can decrease proliferation.  Conversely, ligation of CD279 on primed T cells can stimulate IL-10 production.  High levels of CD274 present in Renal cell carcinoma are associated with poor prognosis (1).  Tumor expressed CD274 can increase apoptosis of tumor specific T cells resulting in better tumor cell survival (2).  Gamma Interferon and PHA can up regulate CD274 expression on T cells.

Molecular Structure:   A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa).

muCD8 apha signal peptide residual amino acids+ linker: (1) kpqapelrgsas

CD274 mature EC:  (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr

Linker +Murine IgG2a Hinge + Fc (235 aa): (237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)

Predicted monomeric (non glycosylated) molecular weight: 54.4 kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.

Transfectant Cell Line:  CHO

References:

1) Cancer Research (April 2006) 66:3381.

2) J Molecular Medicine (Feb 2004) 81(5):281. 

3) Int J Hematol (Nov 2003) 78(4):321.

USD $325.00
In cart: 0
= $325.00
Catalog #:
541-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
CD274, B7H1, B7-H1, PDram Death Ligand-L1, Prog
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads