CD70-muCD8 Purified (with Antibiotics)

Human CD70 (TNFSF7) is the ligand for CD27 (TNFRSF7) and is notably absent on resting lymphocytes. CD70 is expressed after activation on about 20% of T cells and on about 70% of B cells. Recombinant CD70-muCD8 binds to cell surface CD27 on human peripheral blood leukocytes. Recombinant CD70 constructs have been used to elicit  T cell responses in vitro(6) and in vivo (5).

Molecular Structure:  A soluble molecule consisting of the extracellular domain (167aa) of murine CD8 alpha fused to 146 (c-term) amino acids of the extracellular domain of human CD70, with a predicted monomeric weight of 34.8 kd.  

Sequence for extracellular mature murine CD8alpha: (28) kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvnstttkpvlrtpspvhptgtsqpqrpedcrprgsvkgtgldfacd(194);

Linking amino acids:  gt   ;

extracellular human CD70: (48) lpleslgwdvaelqlnhtgpqqdprlywqggpalgrsflhgpeldkgqlrihrdgiymvhiqvtlaicssttasrhhpttlavgicspasrsisllrlsfhqgctivsqrltplargdtlctnltgtllpsrntdetffgvqwvrp(193).

Transfectant Cell Line:  CHO

Functional Application:  CD70-muCD8 binds to cell surface CD27 on  a subset of T cells

References: 

1) R.Q. Hintzen, et al, (1994) J Immunol 152: 1762-1773. 

2) M.R. Bowman, et al, (1994) J Immunol 152: 1756-1761.

3) Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1137-1138.

4) K. Agematsu, et al, (1995) J Immunol 154: 3627-3635.

5) T. F. Rowley , A Al-Shamkhani, (2004) J Immunol 172: 6039-6046.

6) J. M.Carr, D. T. Fearon, et al. (2006) PNAS:103(51):19454-19459

USD $325.00
In cart: 0
= $325.00
Catalog #:
537-020
Form:
Pur/WA
Size:
25 µg
Alternate Name:
Ki-24
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads