CD268(BAFFR)-muIg Purified (Preservative-free)

The human B cell activating factor (BAFF) and APRIL(a proliferation inducing ligand) are both type II molecules belonging to the TNF superfamily. They are expressed by non-B cells, and are down regulated by mitogenic stimulation(2).  BAFF and APRIL bind to at least two receptors: TACI (transmembrane activator and CAML-interactor) and BCMA (B cell maturation antigen), both of which are restricted to B cells(3,4).  Ligation of these receptors with recombinant BAFF dramatically increases IgM production by peripheral blood B cells(1).  A third receptor  for BAFF (BAFF-R) has been described(5). BAFF and BAFFR knockout mice have a reduced numbers of mature B cells in the periphery, however TACI and BCMA knockouts do not share this phenotype, suggesting that BAFF-R may the primary receptor for BAFF in mice(8,9,10).  Cell surface BAFF can be proteolytically cleaved to form a soluble trimeric molecule(2). Levels of soluble BAFF correspond with levels of autoantibodies in Sjogren’s Syndrome(11).  Recombinant human BAFFR-muIg binds to recombinant BAFF-muCD8 and can inhibit binding of this molecule to receptors on Raji cells.

Molecular Structure:  A soluble molecule consisting of the extracellular (60aa) domain of human BAFFR fused  to the  murine IgG2a Fc (232 aa).  Predicted non glycosylated monomeric weight:  33.5 kd.

Murine CD8alpha leader:  kpqapelrgs  

linker: gs   

BAFFR (EC): rgprslrgrdapaptpcvpaecfdllvrhcvacgllrtprpkpagassppprtal     

linker: gt

Murine IgG2a Fc + hinge: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Transfectant Cell Line:  CHO

Functional Application:  BAFFR-muIg binds to recombinant BAFF-muCD8 and can inhibit this molecule’s abiltiy to bind to receptors on Raji cells.

References:

1) Schneider P., J. Tschopp, et al. J. Exp. Med. 1999, 189(11):1747-1756.

2) Shu, H.B., H. Johnson, W.H. Hui. J Leukoc Biol 1999, 65:680-683.

3) Marsters, S.A., A. Ashkenazi, et al. 2000, Curr Biol 10:785-788.

4) Xia, X., H. Hsu, et al. 2000, J Exp Med, 192(1): 137-143.

5) Thompson J.S., C. Ambrose, et al. Science 2001, 293: 2108-2111.

6)Roschke,V, T.S. Migone, et al. J Immunol . 2002, 169: 4314-4321.

7) MacLennan, C.M., C.G. Vinuesa, 2002, Immunity 17:235-238.

8) B. Schiemann, et al, (2001) Science 293: 2111-2114.

9) S.M. Harless,et al, (2001) Curr Biol 11: 1988-1989.

10) Mol Cell Biol (2001) 21: 4067-4074.

11) X. Mariette, et al, (2003) Ann Rhem Dis 62: 168-171.

USD $325.00
In cart: 0
= $325.00
Catalog #:
524-820
Form:
Pur/PF
Size:
25 µg
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads