CD269(BCMA)-muIg Purified (with Antibiotics)
Molecular Structure: A soluble molecule consisting of the murine CD8 alpha signal peptide( 10 amino acids), extracellular (51aa) domain of human BCMA fused to the murine IgG2a Fc (235 aa).
Predicted non glycosylated monomeric weight: 33 kd. Protein is dimeric and runs at ~70kD in SDS-PAGE under native conditions.
Sequence:
Residual signal peptide and linker amino acids (1) kpqapelrgs(10)
BCMA mature extracellular domain: (11)agqcsqneyfdsllhacipcqlrcssntppltcqrycnasvtnsvkgtnai(61)
linker + Murine IgG2a Fc + Hinge domain:
(62) gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(296)
Transfectant Cell Line: CHO
Functional Application: BCMA-muIg binds to recombinant BAFF-muCD8 and can inhibit this molecule’s abiltiy to bind to receptors on Raji cells. It has been used in vitro to block binding of recombinant BAFF (6) and function of APRIL (7).
References:
1) Schneider P., J. Tschopp, et al. J. Exp. Med. 1999, 189 (11):1747-1756.
2) Shu, H.B., H. Johnson, W.H. Hui. J Leukoc Biol 1999, 65:680-683.
3) Marsters, S.A., A. Ashkenazi, et al. 2000, Curr Biol 10:785-788.
4) Xia, X., H. Hsu, et al. 2000, J Exp Med , 192(1): 137-143.
5) Thompson J.S., C. Ambrose, et al. Science 2001, 293: 2108-2111.
6) Xu W, A Cerutti, et al. (2007) Nat Immunol 8(3): 294-303. PMID: 17259987.
7) Bing He, Andrea Cerutti, et al. (2007) Immunity 26(6): 812-826. https://doi.org/10.1016/j.immuni.2007.04.014
