CD134(OX40)-muIg Biotinylated

Human CD134 (OX40) (ACT35) is an activation-associated antigen which is predominantly expressed on activated CD4 positive cells.  CD134 antigen is a member of the tumor necrosis factor (TNF) receptor family of molecules and may be involved with regulating T cell-dependent B cell proliferation and differentiation (2).

Molecular Structure:  A soluble fusion protein consisting of the extracellular (177 aa) domain of  mature extracellular human CD134 fused to murine IgG2a Fc (232 aa), with a predicted monomeric molecular weight of 45.6 kd.

CD134 (mature EC): (29)lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr(205)

+linker: gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight of 45.6 kd.  Fusion construct is dimeric and runs at about 105 kd in non reduced SDS-PAGE.

Transfectant Cell Line:  CHO

Functional Application:  CD134-muIg fusion protein blocks binding of anti-human CD134 Ab and Recombinant CD252-muCD8 to human tumor cells.  CD134-muIg has been used  to dampen IFN gamma production by human benign prostate hyperplastic cells in vitro (6).

References: 

1.   U. Latza, et al, (1994) Eur J Immunol  24: 677-683. 

2.  E. Stuber, et al, (1995) Immunity  2: 507-521. 

3.    Leukocyte Typing IV (W. Knapp, et al, eds.) Oxford University Press, Oxford, (1989) p. 464-465. 

4.   Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1157-1160.

5. Nature Structural & Molecular Biology  12, 60 – 66 (2004) 

6. G Penna, L Adorini, et al (2009) J Immunol 182: 4056-4064. PMID: 19299703

USD $400.00
In cart: 0
= $400.00
Catalog #:
513-030
Form:
Biotin
Size:
25 µg
Alternate Name:
OX40, ACT35
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads