CD134(OX40)-muIg Biotinylated
Human CD134 (OX40) (ACT35) is an activation-associated antigen which is predominantly expressed on activated CD4 positive cells. CD134 antigen is a member of the tumor necrosis factor (TNF) receptor family of molecules and may be involved with regulating T cell-dependent B cell proliferation and differentiation (2).
Molecular Structure: A soluble fusion protein consisting of the extracellular (177 aa) domain of mature extracellular human CD134 fused to murine IgG2a Fc (232 aa), with a predicted monomeric molecular weight of 45.6 kd.
CD134 (mature EC): (29)lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr(205)
+linker: gt
fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg
Predicted monomeric molecular weight of 45.6 kd. Fusion construct is dimeric and runs at about 105 kd in non reduced SDS-PAGE.
Transfectant Cell Line: CHO
Functional Application: CD134-muIg fusion protein blocks binding of anti-human CD134 Ab and Recombinant CD252-muCD8 to human tumor cells. CD134-muIg has been used to dampen IFN gamma production by human benign prostate hyperplastic cells in vitro (6).
References:
1. U. Latza, et al, (1994) Eur J Immunol 24: 677-683.
2. E. Stuber, et al, (1995) Immunity 2: 507-521.
3. Leukocyte Typing IV (W. Knapp, et al, eds.) Oxford University Press, Oxford, (1989) p. 464-465.
4. Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1157-1160.
5. Nature Structural & Molecular Biology 12, 60 – 66 (2004)
6. G Penna, L Adorini, et al (2009) J Immunol 182: 4056-4064. PMID: 19299703