CD86-muIg Purified (Preservative-free)

Human CD86 (B7-2) is a costimulating ligand for CD28 and CTLA-4.  CD86 is expressed on activated B cells and blood monocytes (3). 

Molecular Structure:  A soluble fusion protein consisting of the extracellular (224 aa) domain of  human CD86 fused to murine IgG2a Fc.  Compared to CD86 reference sequence Genebank #HUMB72A, the following polymorphisms are present:  V(54)A,  I(185)V, I(216)T.  Ancell now has three polymorphic variants of CD86-muIg available (see attachment).

CD86 EC  (224 aa):  (26)lkiqayfnetadlpcqfansqnqslselavfwqdqenlvlnevylgkekfdsvhskymgrtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvlanfsqpeivpisnitenvyinltcssihgypepkkmsvllrtknstieydgvmqksqdnvtelydvsislsvsfpdvtsnmttfciletdktrllsspfsieledpqpppdhip(247)

+linker (2 aa):  gt

Murine IgG2a Fc +Hinge (233 aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight: 52.2 kd.  The molecule is dimeric and runs at about 115 kd in SDS-PAGE under native conditions.

Transfectant Cell Line:  CHO

Functional Application:   CD86-muIg fusion protein binds to native and recombinant CD152.

References: 

1.  C. Caux, et al, (1994) J Exp Med  180: 1841-1847. 

2.   C.B. Thompson, (1995) Cell  81: 979-982. 

3.  Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 703-705. 

4.   D. Mauri, et al, (1995) J Immunol  155: 118-127.

USD $325.00
In cart: 0
= $325.00
Catalog #:
509-820
Form:
Pur/PF
Size:
25 µg
Alternate Name:
B7-2
Applications:
EIA, FC

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads