CD95(Fas)-huIg Purified (with Antibiotics)

Human CD95 (APO-1/FAS) is a type I cell surface glycoprotein that is strongly upregulated on activated T cells, B cells, NK cells and thymocytes (1).  CD95 plays an important role in programmed cell death or apoptosis (2).  Apoptosis appears to be a mechanism for regulating the immune response (3, 4).

Molecular Structure:   A soluble fusion protein consisting of the mature extracellular (159 aa) domain of human CD95 fused to a linker (4 aa) and human IgG1 Fc + hinge (232 aa), with a (non glycosylated) predicted monomeric molecular weight of 44.3 kd.

CD95(EC):

rlssksvnaqvtdinskglelrktvttvetqnleglhhdgqfchkpcppgerkardctvngdepdcvpcqegkeytdkahfsskcrrcrlcdeghgleveinctrtqntkcrckpnffcnstvcehcdpctkcehgiikectltsntkckeegsrsnlg

 linker:  gtyv

Human Ig Fc + hinge:

eprscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk

Transfectant Cell Line:  CHO

Functional Application:  CD95-huIg fusion protein inhibits CD178 mediated apoptosis of Jurkat cells.

References: 

1.  Leukocyte Typing V (S.F. Schlossman, et al, eds.)  Oxford University Press, Oxford  (1995) p. 1142-1148. 

2.  S. Nagata & P. Golstein (1995) Science  267: 1449-1456. 

3.  S. Nagata & T. Suda (1995) Immunol Today  16: 39-43. 

4.  D.H. Lynch, F. Ramsdell & M.R. Alderson (1995) Immunol Today  16: 569-574.

5. H Wajant, (2003) Essays Biochem 39:53-71.

6. A. Ackery, M G Fehlings, (2006) J Neurotrauma 23(5): 604-616.

USD $325.00
In cart: 0
= $325.00
Catalog #:
506-020
Form:
Pur/WA
Size:
25 µg
Alternate Name:
APO-1, FAS
Applications:
EIA

Application Key

FC
Flow Cytometry
WB
Western blot
EIA
Enzyme Immunoassay
IHC
Immunohistochemistry
ICC
Immunocytochemistry
FPS
Fixed paraffin section
PS
Paraffin section
IP
Immunoprecipitation
FX
Fixed cells or tissues

Applications indicated have been either tested in-house or reported. Products may be functional for applications not indicated.

1
Categories:

Downloads