CD95(Fas)-huIg Purified (with Antibiotics)

Human CD95 (APO-1/FAS) is a type I cell surface glycoprotein that is strongly upregulated on activated T cells, B cells, NK cells and thymocytes (1).  CD95 plays an important role in programmed cell death or apoptosis (2).  Apoptosis appears to be a mechanism for regulating the immune response (3, 4).

Molecular Structure:   A soluble fusion protein consisting of the mature extracellular (159 aa) domain of human CD95 fused to a linker (4 aa) and human IgG1 Fc + hinge (232 aa), with a (non glycosylated) predicted monomeric molecular weight of 44.3 kd.

CD95(EC):

rlssksvnaqvtdinskglelrktvttvetqnleglhhdgqfchkpcppgerkardctvngdepdcvpcqegkeytdkahfsskcrrcrlcdeghgleveinctrtqntkcrckpnffcnstvcehcdpctkcehgiikectltsntkckeegsrsnlg

 linker:  gtyv

Human Ig Fc + hinge:

eprscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk

Transfectant Cell Line:  CHO

Functional Application:  CD95-huIg fusion protein inhibits CD178 mediated apoptosis of Jurkat cells.

References: 

1.  Leukocyte Typing V (S.F. Schlossman, et al, eds.)  Oxford University Press, Oxford  (1995) p. 1142-1148. 

2.  S. Nagata & P. Golstein (1995) Science  267: 1449-1456. 

3.  S. Nagata & T. Suda (1995) Immunol Today  16: 39-43. 

4.  D.H. Lynch, F. Ramsdell & M.R. Alderson (1995) Immunol Today  16: 569-574.

5. H Wajant, (2003) Essays Biochem 39:53-71.

6. A. Ackery, M G Fehlings, (2006) J Neurotrauma 23(5): 604-616.